PNPT1 Antikörper (Middle Region)
-
- Target Alle PNPT1 Antikörper anzeigen
- PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PNPT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PNPT1 antibody was raised against the middle region of PNPT1
- Aufreinigung
- Affinity purified
- Immunogen
- PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
- Top Product
- Discover our top product PNPT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PNPT1 Blocking Peptide, catalog no. 33R-1698, is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))
- Andere Bezeichnung
- PNPT1 (PNPT1 Produkte)
- Synonyme
- COXPD13 antikoerper, DFNB70 antikoerper, OLD35 antikoerper, PNPASE antikoerper, old-35 antikoerper, 1200003F12Rik antikoerper, Old35 antikoerper, PNPase antikoerper, Pnptl1 antikoerper, polyribonucleotide nucleotidyltransferase 1, mitochondrial antikoerper, polyribonucleotide nucleotidyltransferase 1 antikoerper, CpipJ_CPIJ005886 antikoerper, PNPT1 antikoerper, Pnpt1 antikoerper
- Hintergrund
- PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.
- Molekulargewicht
- 86 kDa (MW of target protein)
-