RAE1 Antikörper

Produktnummer ABIN633249

Produktdetails anti-RAE1 Antikörper

Target: RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAE1 Blocking Peptide, catalog no. 33R-8290, is also available for use as a blocking control in assays to test for specificity of this RAE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAE1

Target: RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))

Andere Bezeichnung: RAE1 (RAE1 Produkte)

Synonyme: gle2 antikoerper, mig14 antikoerper, mnrp41 antikoerper, mrnp41 antikoerper, MRNP41 antikoerper, zgc:56449 antikoerper, zgc:77723 antikoerper, 3230401I12Rik antikoerper, 41 antikoerper, D2Ertd342e antikoerper, MNRP antikoerper, MNRP41 antikoerper, MIG14 antikoerper, Mnrp41 antikoerper, dJ481F12.3 antikoerper, dJ800J21.1 antikoerper, ribonucleic acid export 1 antikoerper, RAE1 RNA export 1 homolog antikoerper, ribonucleic acid export 1 L homeolog antikoerper, rae1 antikoerper, LOC664096 antikoerper, RAE1 antikoerper, rae1.L antikoerper, Rae1 antikoerper

Hintergrund: RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom