RDBP Antikörper (N-Term)
-
- Target Alle RDBP Antikörper anzeigen
- RDBP (RD RNA Binding Protein (RDBP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RDBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RDBP antibody was raised against the N terminal of RDBP
- Aufreinigung
- Affinity purified
- Immunogen
- RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS
- Top Product
- Discover our top product RDBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RDBP Blocking Peptide, catalog no. 33R-5514, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDBP (RD RNA Binding Protein (RDBP))
- Andere Bezeichnung
- RDBP (RDBP Produkte)
- Hintergrund
- RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).
- Molekulargewicht
- 43 kDa (MW of target protein)
-