SLIRP Antikörper (N-Term)

Produktnummer ABIN633258

Produktdetails anti-SLIRP Antikörper

Target: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLIRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF156 antibody was raised against the N terminal Of C14 rf156

Aufreinigung: Affinity purified

Immunogen: C14 ORF156 antibody was raised using the N terminal Of C14 rf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF156 Blocking Peptide, catalog no. 33R-7071, is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF156 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLIRP

Target: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Andere Bezeichnung: C14ORF156 (SLIRP Produkte)

Synonyme: C14orf156 antikoerper, SLIRP antikoerper, DKFZp468C196 antikoerper, DC50 antikoerper, PD04872 antikoerper, 1810035L17Rik antikoerper, C10H14orf156 antikoerper, SRA stem-loop interacting RNA binding protein antikoerper, Slirp antikoerper, C14orf156 antikoerper, SLIRP antikoerper

Hintergrund: As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

Molekulargewicht: 12 kDa (MW of target protein)