SLIRP Antikörper (N-Term)
-
- Target Alle SLIRP Antikörper anzeigen
- SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLIRP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C14 ORF156 antibody was raised against the N terminal Of C14 rf156
- Aufreinigung
- Affinity purified
- Immunogen
- C14 ORF156 antibody was raised using the N terminal Of C14 rf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
- Top Product
- Discover our top product SLIRP Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C14ORF156 Blocking Peptide, catalog no. 33R-7071, is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF156 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))
- Andere Bezeichnung
- C14ORF156 (SLIRP Produkte)
- Hintergrund
- As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.
- Molekulargewicht
- 12 kDa (MW of target protein)
-