DHX15 Antikörper
-
- Target Alle DHX15 Antikörper anzeigen
- DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))
-
Reaktivität
- Human, Maus, Ratte, Arabidopsis
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL
- Top Product
- Discover our top product DHX15 Primärantikörper
-
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15) (AA 371-502) antibody
DHX15 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15) (AA 107-156) antibodyDHX15 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Huhn, Schwein, Xenopus laevis, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15) (AA 686-735) antibodyDHX15 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Huhn, Schwein, Xenopus laevis, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15) (AA 750-795), (C-Term) antibodyDHX15 Reaktivität: Human WB, IHC (p), IHC, IP Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX15 Blocking Peptide, catalog no. 33R-10140, is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))
- Andere Bezeichnung
- DHX15 (DHX15 Produkte)
- Synonyme
- DBP1 antikoerper, DDX15 antikoerper, HRH2 antikoerper, PRP43 antikoerper, PRPF43 antikoerper, PrPp43p antikoerper, im:2639158 antikoerper, wu:fb38f09 antikoerper, wu:fk62f05 antikoerper, DDBDRAFT_0186395 antikoerper, DDBDRAFT_0233403 antikoerper, DDB_0186395 antikoerper, DDB_0233403 antikoerper, Ddx15 antikoerper, mDEAH9 antikoerper, DHX15 antikoerper, DEAH-box helicase 15 antikoerper, DEAH (Asp-Glu-Ala-His) box helicase 15 antikoerper, DEAH-box helicase 15 L homeolog antikoerper, DEAD/DEAH box helicase antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 15 antikoerper, DHX15 antikoerper, dhx15 antikoerper, dhx15.L antikoerper, Dhx15 antikoerper
- Hintergrund
- DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.
- Molekulargewicht
- 91 kDa (MW of target protein)
-
