EXOSC3 Antikörper (Middle Region)
-
- Target Alle EXOSC3 Antikörper anzeigen
- EXOSC3 (Exosome Component 3 (EXOSC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOSC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EXOSC3 antibody was raised against the middle region of EXOSC3
- Aufreinigung
- Affinity purified
- Immunogen
- EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK
- Top Product
- Discover our top product EXOSC3 Primärantikörper
-
anti-Exosome Component 3 (EXOSC3) (AA 1-275) antibody
EXOSC3 Reaktivität: Human WB, ELISA, IP, IHC (p) Wirt: Maus Monoclonal 5C3 unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 1-275) antibodyEXOSC3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 1-275) antibodyEXOSC3 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 176-274) antibodyEXOSC3 Reaktivität: Human ELISA, IP Wirt: Maus Monoclonal 3E5 unconjugated
anti-Exosome Component 3 (EXOSC3) (C-Term) antibodyEXOSC3 Reaktivität: Human, Maus, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Schwein, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 81-130) antibodyEXOSC3 Reaktivität: Human, Maus, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Schwein, Affe, Huhn, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) antibodyEXOSC3 Reaktivität: Human WB, FACS Wirt: Maus Monoclonal 1D6 unconjugated
anti-Exosome Component 3 (EXOSC3) (C-Term) antibodyEXOSC3 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 2-275) antibodyEXOSC3 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (C-Term) antibodyEXOSC3 Reaktivität: Human, Maus, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Schwein, Zebrafisch (Danio rerio), Affe, Fledermaus, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOSC3 Blocking Peptide, catalog no. 33R-9133, is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC3 (Exosome Component 3 (EXOSC3))
- Andere Bezeichnung
- EXOSC3 (EXOSC3 Produkte)
- Synonyme
- PCH1B antikoerper, RP11-3J10.8 antikoerper, RRP40 antikoerper, Rrp40p antikoerper, bA3J10.7 antikoerper, hRrp-40 antikoerper, p10 antikoerper, 2310005D06Rik antikoerper, AI593501 antikoerper, Rrp40 antikoerper, im:7140537 antikoerper, zgc:112345 antikoerper, exosome component 3 antikoerper, exosome component 3 L homeolog antikoerper, EXOSC3 antikoerper, exosc3.L antikoerper, Exosc3 antikoerper, exosc3 antikoerper
- Hintergrund
- EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interaktom
-
