SNRPB Antikörper (N-Term)

Produktnummer ABIN633272

Produktdetails anti-SNRPB Antikörper

Target: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SNRPB antibody was raised against the N terminal of SNRPB

Aufreinigung: Affinity purified

Immunogen: SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPB Blocking Peptide, catalog no. 33R-2018, is also available for use as a blocking control in assays to test for specificity of this SNRPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPB

Target: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Andere Bezeichnung: SNRPB (SNRPB Produkte)

Synonyme: AL024368 antikoerper, AU018828 antikoerper, SM-B antikoerper, SM11 antikoerper, SMB antikoerper, SNRNP-B antikoerper, SNRB' antikoerper, SNRPB' antikoerper, Snrpn antikoerper, zgc:77315 antikoerper, cod antikoerper, sm-b/b' antikoerper, smb/b' antikoerper, smb/smb' antikoerper, snrnp-b antikoerper, snrpb1 antikoerper, snurf antikoerper, DDBDRAFT_0206555 antikoerper, DDBDRAFT_0233178 antikoerper, DDB_0206555 antikoerper, DDB_0233178 antikoerper, COD antikoerper, SNRPB1 antikoerper, Sm-B/B' antikoerper, SmB/B' antikoerper, SmB/SmB' antikoerper, snRNP-B antikoerper, Sm-B' antikoerper, SmB' antikoerper, snRNP-B' antikoerper, snRPB' antikoerper, small nuclear ribonucleoprotein B antikoerper, small nuclear ribonucleoprotein polypeptides B and B1 antikoerper, small nuclear ribonucleoprotein polypeptide-like antikoerper, small nuclear ribonucleoprotein polypeptides B and B1 L homeolog antikoerper, mRNA splicing factor antikoerper, LSM domain-containing protein antikoerper, Snrpb antikoerper, SNRPL antikoerper, snrpb antikoerper, SNRPB antikoerper, snrpb.L antikoerper, snrpB antikoerper

Hintergrund: SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization