SNRPD1 Antikörper (N-Term)

Produktnummer ABIN633274

Produktdetails anti-SNRPD1 Antikörper

Target: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SNRPD1 antibody was raised against the N terminal of SNRPD1

Aufreinigung: Affinity purified

Immunogen: SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPD1 Blocking Peptide, catalog no. 33R-6711, is also available for use as a blocking control in assays to test for specificity of this SNRPD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPD1

Target: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Andere Bezeichnung: SNRPD1 (SNRPD1 Produkte)

Synonyme: HsT2456 antikoerper, SMD1 antikoerper, SNRPD antikoerper, Sm-D1 antikoerper, SNRPD2 antikoerper, AA407109 antikoerper, AL023031 antikoerper, CHUNP6882 antikoerper, fk26a01 antikoerper, snprd1 antikoerper, snrnpd1 antikoerper, wu:fk26a01 antikoerper, zgc:86929 antikoerper, small nuclear ribonucleoprotein D1 polypeptide antikoerper, small nuclear ribonucleoprotein D1 antikoerper, small nuclear ribonucleoprotein D1 polypeptide L homeolog antikoerper, SNRPD1 antikoerper, Snrpd1 antikoerper, snrpd1 antikoerper, snrpd1.L antikoerper

Hintergrund: SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization