KRR1 Antikörper (C-Term)

Produktnummer ABIN633275

Produktdetails anti-KRR1 Antikörper

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KRR1 antibody was raised against the C terminal of KRR1

Aufreinigung: Affinity purified

Immunogen: KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KRR1 Blocking Peptide, catalog no. 33R-4253, is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRR1

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Andere Bezeichnung: KRR1 (KRR1 Produkte)

Synonyme: hrb2 antikoerper, zgc:136398 antikoerper, HRB2 antikoerper, RIP-1 antikoerper, 2610511F02Rik antikoerper, AI255219 antikoerper, AI428520 antikoerper, D10Ertd773e antikoerper, Hrb2 antikoerper, KRR1, small subunit (SSU) processome component, homolog S homeolog antikoerper, KRR1, small subunit (SSU) processome component, homolog (yeast) antikoerper, KRR1, small subunit processome component homolog antikoerper, KRR1 small subunit processome component homolog antikoerper, krr1.S antikoerper, krr1 antikoerper, KRR1 antikoerper, LOC475405 antikoerper, Krr1 antikoerper

Hintergrund: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Molekulargewicht: 44 kDa (MW of target protein)