SRSF3 Antikörper (N-Term)
-
- Target Alle SRSF3 Antikörper anzeigen
- SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRSF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFRS3 antibody was raised against the N terminal of SFRS3
- Aufreinigung
- Affinity purified
- Immunogen
- SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS
- Top Product
- Discover our top product SRSF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS3 Blocking Peptide, catalog no. 33R-8935, is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))
- Andere Bezeichnung
- SFRS3 (SRSF3 Produkte)
- Synonyme
- SFRS3 antikoerper, SRp20 antikoerper, AL024116 antikoerper, Sfrs3 antikoerper, X16 antikoerper, sfrs3 antikoerper, srp20 antikoerper, SRP20 antikoerper, si:zc263a23.9 antikoerper, zgc:86626 antikoerper, serine and arginine rich splicing factor 3 antikoerper, serine/arginine-rich splicing factor 3 antikoerper, serine/arginine-rich splicing factor 3 S homeolog antikoerper, serine/arginine-rich splicing factor 3a antikoerper, SRSF3 antikoerper, Srsf3 antikoerper, srsf3.S antikoerper, srsf3a antikoerper
- Hintergrund
- SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.
- Molekulargewicht
- 19 kDa (MW of target protein)
-