RTCD1 Antikörper (N-Term)

Produktnummer ABIN633294

Produktdetails anti-RTCD1 Antikörper

Target: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RTCD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RTCD1 antibody was raised against the N terminal of RTCD1

Aufreinigung: Affinity purified

Immunogen: RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RTCD1 Blocking Peptide, catalog no. 33R-9747, is also available for use as a blocking control in assays to test for specificity of this RTCD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTCD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RTCD1

Target: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Andere Bezeichnung: RTCD1 (RTCD1 Produkte)

Synonyme: Dmel\\CG4061 antikoerper, EG:22E5.3 antikoerper, RTC1_DROME antikoerper, DKFZp469J2025 antikoerper, cb158 antikoerper, rtcd1 antikoerper, sb:cb158 antikoerper, wu:fc62c03 antikoerper, zgc:56339 antikoerper, RTCD1 antikoerper, RPC antikoerper, RTC1 antikoerper, 2310009A18Rik antikoerper, AI450277 antikoerper, Rtcd1 antikoerper, RNA 3'-terminal phosphate cyclase antikoerper, Rtca antikoerper, RTCA antikoerper, rtca antikoerper, rtca.L antikoerper

Hintergrund: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.

Molekulargewicht: 39 kDa (MW of target protein)