RTCD1 Antikörper (N-Term)
-
- Target Alle RTCD1 Antikörper anzeigen
- RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RTCD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RTCD1 antibody was raised against the N terminal of RTCD1
- Aufreinigung
- Affinity purified
- Immunogen
- RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK
- Top Product
- Discover our top product RTCD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RTCD1 Blocking Peptide, catalog no. 33R-9747, is also available for use as a blocking control in assays to test for specificity of this RTCD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTCD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))
- Andere Bezeichnung
- RTCD1 (RTCD1 Produkte)
- Hintergrund
- RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.
- Molekulargewicht
- 39 kDa (MW of target protein)
-