JAKMIP1 Antikörper (Middle Region)
-
- Target Alle JAKMIP1 Antikörper anzeigen
- JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser JAKMIP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- JAKMIP1 antibody was raised against the middle region of JAKMIP1
- Aufreinigung
- Affinity purified
- Immunogen
- JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
- Top Product
- Discover our top product JAKMIP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))
- Andere Bezeichnung
- JAKMIP1 (JAKMIP1 Produkte)
- Synonyme
- MGC81051 antikoerper, Gababrbp antikoerper, JAMIP1 antikoerper, MARLIN1 antikoerper, 5830437M04Rik antikoerper, C330021K24Rik antikoerper, Marlin-1 antikoerper, janus kinase and microtubule interacting protein 1 antikoerper, janus kinase and microtubule interacting protein 1 L homeolog antikoerper, janus kinase and microtubule-interacting protein 1 antikoerper, Celf_2690 antikoerper, JAKMIP1 antikoerper, jakmip1.L antikoerper, LOC100070079 antikoerper, jakmip1 antikoerper, LOC100432594 antikoerper, Jakmip1 antikoerper
- Hintergrund
- JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.
- Molekulargewicht
- 97 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-