SEPSECS Antikörper (N-Term)

Produktnummer ABIN633298

Produktdetails anti-SEPSECS Antikörper

Target: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEPSECS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLA/LP antibody was raised against the N terminal of SLA/LP

Produktmerkmale: Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP

Aufreinigung: Affinity purified

Immunogen: SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLA/LP Blocking Peptide, catalog no. 33R-5871, is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA/LP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEPSECS

Target: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Andere Bezeichnung: SLA/LP (SEPSECS Produkte)

Synonyme: LP antikoerper, PCH2D antikoerper, SLA antikoerper, SLA/LP antikoerper, 9130208G10 antikoerper, AA986712 antikoerper, D5Ertd135e antikoerper, SecS antikoerper, sla/lpl antikoerper, zgc:55980 antikoerper, sepsecs antikoerper, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase antikoerper, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase L homeolog antikoerper, SEPSECS antikoerper, Sepsecs antikoerper, sepsecs antikoerper, sepsecs.L antikoerper

Substanzklasse: Antibody

Hintergrund: SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom