SEPSECS Antikörper (N-Term)
-
- Target Alle SEPSECS Antikörper anzeigen
- SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEPSECS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SLA/LP antibody was raised against the N terminal of SLA/LP
- Produktmerkmale
- Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP
- Aufreinigung
- Affinity purified
- Immunogen
- SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG
- Top Product
- Discover our top product SEPSECS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLA/LP Blocking Peptide, catalog no. 33R-5871, is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA/LP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))
- Andere Bezeichnung
- SLA/LP (SEPSECS Produkte)
- Substanzklasse
- Antibody
- Hintergrund
- SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-