RBMS2 Antikörper (N-Term)

Produktnummer ABIN633313

Produktdetails anti-RBMS2 Antikörper

Target: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBMS2 antibody was raised against the N terminal of RBMS2

Aufreinigung: Affinity purified

Immunogen: RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMS2 Blocking Peptide, catalog no. 33R-6197, is also available for use as a blocking control in assays to test for specificity of this RBMS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMS2

Target: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Andere Bezeichnung: RBMS2 (RBMS2 Produkte)

Synonyme: SCR3 antikoerper, 2610315E04Rik antikoerper, Scr3 antikoerper, zgc:100836 antikoerper, RBMS2 antikoerper, RNA binding motif single stranded interacting protein 2 antikoerper, RNA binding motif, single stranded interacting protein 2 antikoerper, RNA binding motif, single stranded interacting protein 2b antikoerper, RBMS2 antikoerper, Rbms2 antikoerper, rbms2b antikoerper

Hintergrund: RBMS2 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding.

Molekulargewicht: 44 kDa (MW of target protein)