XRN1 Antikörper (Middle Region)
-
- Target Alle XRN1 Antikörper anzeigen
- XRN1 (5'-3' Exoribonuclease 1 (XRN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XRN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- XRN1 antibody was raised against the middle region of XRN1
- Aufreinigung
- Affinity purified
- Immunogen
- XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM
- Top Product
- Discover our top product XRN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XRN1 Blocking Peptide, catalog no. 33R-5282, is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRN1 (5'-3' Exoribonuclease 1 (XRN1))
- Andere Bezeichnung
- XRN1 (XRN1 Produkte)
- Synonyme
- wu:fk92c07 antikoerper, zgc:63635 antikoerper, SEP1 antikoerper, Dhm2 antikoerper, exo antikoerper, mXrn1 antikoerper, RGD1309713 antikoerper, 5'-3' exoribonuclease 1 antikoerper, xrn1 antikoerper, XRN1 antikoerper, Tsp_05930 antikoerper, Xrn1 antikoerper
- Hintergrund
- SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.
- Molekulargewicht
- 194 kDa (MW of target protein)
-