MIF4GD Antikörper (N-Term)
-
- Target Alle MIF4GD Antikörper anzeigen
- MIF4GD (MIF4G Domain Containing (MIF4GD))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MIF4GD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MIF4 GD antibody was raised against the N terminal of MIF4 D
- Aufreinigung
- Affinity purified
- Immunogen
- MIF4 GD antibody was raised using the N terminal of MIF4 D corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR
- Top Product
- Discover our top product MIF4GD Primärantikörper
-
anti-MIF4G Domain Containing (MIF4GD) (AA 137-169) antibody
MIF4GD Reaktivität: Human, Maus WB, FACS, IF Wirt: Kaninchen Polyclonal RB55240 unconjugated
anti-MIF4G Domain Containing (MIF4GD) (C-Term) antibodyMIF4GD Reaktivität: Human, Maus, Hund, Ratte, Meerschweinchen, Rind (Kuh), Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Affe, Schwein, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-MIF4G Domain Containing (MIF4GD) (C-Term) antibodyMIF4GD Reaktivität: Human, Maus, Hund, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-MIF4G Domain Containing (MIF4GD) (C-Term) antibodyMIF4GD Reaktivität: Human, Maus, Hund, Ratte, Meerschweinchen, Rind (Kuh), Pferd, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-MIF4G Domain Containing (MIF4GD) (AA 1-256) antibodyMIF4GD Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-MIF4G Domain Containing (MIF4GD) (N-Term) antibodyMIF4GD Reaktivität: Human, Maus, Hund, Meerschweinchen, Fledermaus, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MIF4GD Blocking Peptide, catalog no. 33R-6024, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MIF4GD (MIF4G Domain Containing (MIF4GD))
- Andere Bezeichnung
- MIF4GD (MIF4GD Produkte)
- Synonyme
- AD023 antikoerper, MIFD antikoerper, SLIP1 antikoerper, 1110014L05Rik antikoerper, 2310075G12Rik antikoerper, RGD1309685 antikoerper, MIF4GD antikoerper, zgc:64152 antikoerper, zgc:110826 antikoerper, ad023 antikoerper, mif4gd antikoerper, mif4gd-a antikoerper, mif4gd-b antikoerper, mifd antikoerper, slip1 antikoerper, MIF4G domain containing antikoerper, MIF4G domain containing a antikoerper, MIF4G domain containing b antikoerper, MIF4G domain containing L homeolog antikoerper, MIF4G domain containing S homeolog antikoerper, MIF4GD antikoerper, Mif4gd antikoerper, mif4gda antikoerper, mif4gdb antikoerper, mif4gd.L antikoerper, mif4gd.S antikoerper
- Hintergrund
- MIF4GD is a protein which contains an MIF4G domain.
- Molekulargewicht
- 29 kDa (MW of target protein)
-
