DHX37 Antikörper
-
- Target Alle DHX37 Antikörper anzeigen
- DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX37 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG
- Top Product
- Discover our top product DHX37 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX37 Blocking Peptide, catalog no. 33R-7211, is also available for use as a blocking control in assays to test for specificity of this DHX37 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX37 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))
- Andere Bezeichnung
- DHX37 (DHX37 Produkte)
- Synonyme
- DDBDRAFT_0187437 antikoerper, DDBDRAFT_0235265 antikoerper, DDB_0187437 antikoerper, DDB_0235265 antikoerper, im:7151586 antikoerper, wu:fd11d06 antikoerper, zgc:158802 antikoerper, DDX37 antikoerper, Gm1050 antikoerper, Gm451 antikoerper, mKIAA1517 antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 37 antikoerper, DEAD/DEAH box helicase antikoerper, DEAH-box helicase 37 antikoerper, DEAH-box helicase 37 L homeolog antikoerper, DHX37 antikoerper, dhx37 antikoerper, dhx37.L antikoerper, Dhx37 antikoerper
- Hintergrund
- DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Molekulargewicht
- 129 kDa (MW of target protein)
-