TROVE2 Antikörper (N-Term)
-
- Target Alle TROVE2 Antikörper anzeigen
- TROVE2 (TROVE Domain Family, Member 2 (TROVE2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TROVE2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- TROVE2 antibody was raised against the N terminal of TROVE2
- Aufreinigung
- Affinity purified
- Immunogen
- TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR
- Top Product
- Discover our top product TROVE2 Primärantikörper
-
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 3-535) antibody
TROVE2 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-100) antibodyTROVE2 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1F2 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (Center) antibodyTROVE2 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-538) antibodyTROVE2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2E10 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibodyTROVE2 Reaktivität: Human WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 51-100) antibodyTROVE2 Reaktivität: Human, Pferd, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibodyTROVE2 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) antibodyTROVE2 Reaktivität: Human WB, ELISA, IHC, IHC (p) Wirt: Maus Monoclonal 2B4 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 20-69) antibodyTROVE2 Reaktivität: Human, Maus, Hund, Meerschweinchen, Kaninchen, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 467-495), (C-Term) antibodyTROVE2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB36981 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TROVE2 Blocking Peptide, catalog no. 33R-7498, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TROVE2 (TROVE Domain Family, Member 2 (TROVE2))
- Andere Bezeichnung
- TROVE2 (TROVE2 Produkte)
- Synonyme
- SSA2 antikoerper, TROVE2 antikoerper, ssa2 antikoerper, ssa2-A antikoerper, RO60 antikoerper, RORNP antikoerper, 1810007I17Rik antikoerper, A530054J02Rik antikoerper, AI646302 antikoerper, SS-A/Ro antikoerper, Ssa antikoerper, Ssa2 antikoerper, TROVE domain family member 2 antikoerper, TROVE domain family, member 2 antikoerper, TROVE domain family member 2 L homeolog antikoerper, TROVE2 antikoerper, trove2 antikoerper, trove2.L antikoerper, Trove2 antikoerper
- Hintergrund
- TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
- Molekulargewicht
- 58 kDa (MW of target protein)
-
