TROVE2 Antikörper (N-Term)

Produktnummer ABIN633333

Produktdetails anti-TROVE2 Antikörper

Target: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TROVE2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: TROVE2 antibody was raised against the N terminal of TROVE2

Aufreinigung: Affinity purified

Immunogen: TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TROVE2 Blocking Peptide, catalog no. 33R-7498, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TROVE2

Target: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Andere Bezeichnung: TROVE2 (TROVE2 Produkte)

Synonyme: SSA2 antikoerper, TROVE2 antikoerper, ssa2 antikoerper, ssa2-A antikoerper, RO60 antikoerper, RORNP antikoerper, 1810007I17Rik antikoerper, A530054J02Rik antikoerper, AI646302 antikoerper, SS-A/Ro antikoerper, Ssa antikoerper, Ssa2 antikoerper, TROVE domain family member 2 antikoerper, TROVE domain family, member 2 antikoerper, TROVE domain family member 2 L homeolog antikoerper, TROVE2 antikoerper, trove2 antikoerper, trove2.L antikoerper, Trove2 antikoerper

Hintergrund: TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.

Molekulargewicht: 58 kDa (MW of target protein)