A1CF Antikörper (N-Term)

Produktnummer ABIN633338

Produktdetails anti-A1CF Antikörper

Target: A1CF (APOBEC1 Complementation Factor (A1CF))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A1CF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: A1 CF antibody was raised against the N terminal of A1 F

Aufreinigung: Affinity purified

Immunogen: A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A1CF Blocking Peptide, catalog no. 33R-2286, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A1CF

Target: A1CF (APOBEC1 Complementation Factor (A1CF))

Andere Bezeichnung: A1CF (A1CF Produkte)

Synonyme: ACF antikoerper, ACF64 antikoerper, ACF65 antikoerper, APOBEC1CF antikoerper, ASP antikoerper, 1810073H04Rik antikoerper, Acf antikoerper, A1cft antikoerper, Apobec-1 antikoerper, acf antikoerper, acf64 antikoerper, acf65 antikoerper, apobec1cf antikoerper, asp antikoerper, A1CF antikoerper, APOBEC1 complementation factor antikoerper, apobec1 complementation factor antikoerper, APOBEC1 complementation factor L homeolog antikoerper, A1CF antikoerper, A1cf antikoerper, a1cf antikoerper, a1cf.L antikoerper

Hintergrund: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.

Molekulargewicht: 65 kDa (MW of target protein)