A1CF Antikörper (N-Term)
-
- Target Alle A1CF Antikörper anzeigen
- A1CF (APOBEC1 Complementation Factor (A1CF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser A1CF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- A1 CF antibody was raised against the N terminal of A1 F
- Aufreinigung
- Affinity purified
- Immunogen
- A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP
- Top Product
- Discover our top product A1CF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
A1CF Blocking Peptide, catalog no. 33R-2286, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A1CF (APOBEC1 Complementation Factor (A1CF))
- Andere Bezeichnung
- A1CF (A1CF Produkte)
- Hintergrund
- Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.
- Molekulargewicht
- 65 kDa (MW of target protein)
-