EIF3B Antikörper (C-Term)
-
- Target Alle EIF3B Antikörper anzeigen
- EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF3 S9 antibody was raised against the C terminal of EIF3 9
- Aufreinigung
- Affinity purified
- Immunogen
- EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
- Top Product
- Discover our top product EIF3B Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF3S9 Blocking Peptide, catalog no. 33R-10226, is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))
- Andere Bezeichnung
- EIF3S9 (EIF3B Produkte)
- Hintergrund
- EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
- Molekulargewicht
- 90 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-