EIF3B Antikörper (C-Term)

Produktnummer ABIN633340

Produktdetails anti-EIF3B Antikörper

Target: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF3 S9 antibody was raised against the C terminal of EIF3 9

Aufreinigung: Affinity purified

Immunogen: EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3S9 Blocking Peptide, catalog no. 33R-10226, is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3B

Target: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Andere Bezeichnung: EIF3S9 (EIF3B Produkte)

Synonyme: EIF3-ETA antikoerper, EIF3-P110 antikoerper, EIF3-P116 antikoerper, EIF3S9 antikoerper, PRT1 antikoerper, AL033316 antikoerper, AL033334 antikoerper, AL033369 antikoerper, AW208965 antikoerper, D5Wsu45e antikoerper, Eif3s9 antikoerper, eif3-eta antikoerper, eif3-p110 antikoerper, eif3-p116 antikoerper, eif3s9 antikoerper, prt1 antikoerper, ATEIF3B-2 antikoerper, EIF3B antikoerper, EUKARYOTIC TRANSLATION INITIATION FACTOR 3B antikoerper, F18A17.30 antikoerper, F18A17_30 antikoerper, eukaryotic translation initiation factor 3B-2 antikoerper, DDBDRAFT_0218512 antikoerper, DDBDRAFT_0233929 antikoerper, DDB_0218512 antikoerper, DDB_0233929 antikoerper, eIF-3-eta antikoerper, eif3b antikoerper, wu:fc17c01 antikoerper, GB10123 antikoerper, eIF3b antikoerper, AO090005000892 antikoerper, CaO19.6584 antikoerper, eIF3 p90 antikoerper, eukaryotic translation initiation factor 3 subunit B antikoerper, eukaryotic translation initiation factor 3, subunit B antikoerper, eukaryotic translation initiation factor 3B-2 antikoerper, eukaryotic initiation factor antikoerper, RNA recognition motif-containing protein RRM antikoerper, eukaryotic translation initiation factor 3b antikoerper, eukaryotic translation initiation factor 3 subunit B L homeolog antikoerper, eukaryotic translation initiation factor 3, subunit Ba antikoerper, eukaryotic translation initiation factor 3 subunit 9 antikoerper, translation initiation factor eIF-3 subunit 9 antikoerper, Eukaryotic translation initiation factor 3 subunit B antikoerper, translation initiation factor eIF3 subunit b antikoerper, EIF3B antikoerper, Eif3b antikoerper, eif3b antikoerper, EIF3B-2 antikoerper, eIF3s9 antikoerper, eif3B antikoerper, eif3b.L antikoerper, eif3ba antikoerper, LOC410100 antikoerper, eIF3-S9 antikoerper, AOR_1_1564174 antikoerper, VDBG_02490 antikoerper, PGTG_13070 antikoerper, Tsp_02250 antikoerper, eif-3.B antikoerper, PRT1 antikoerper

Hintergrund: EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization