A1CF Antikörper (N-Term)
-
- Target Alle A1CF Antikörper anzeigen
- A1CF (APOBEC1 Complementation Factor (A1CF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser A1CF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- A1 CF antibody was raised against the N terminal of A1 F
- Aufreinigung
- Affinity purified
- Immunogen
- A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA
- Top Product
- Discover our top product A1CF Primärantikörper
-
anti-APOBEC1 Complementation Factor (A1CF) (AA 1-594) antibody
A1CF Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (AA 50-120) antibodyA1CF Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (AA 394-423), (C-Term) antibodyA1CF Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB20614 unconjugated
anti-APOBEC1 Complementation Factor (A1CF) antibodyA1CF Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (AA 389-587) antibodyA1CF Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (AA 397-427), (C-Term) antibodyA1CF Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (N-Term) antibodyA1CF Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (N-Term) antibodyA1CF Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (N-Term) antibodyA1CF Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-APOBEC1 Complementation Factor (A1CF) (N-Term) antibodyA1CF Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
A1CF Blocking Peptide, catalog no. 33R-5962, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A1CF (APOBEC1 Complementation Factor (A1CF))
- Andere Bezeichnung
- A1CF (A1CF Produkte)
- Synonyme
- ACF antikoerper, ACF64 antikoerper, ACF65 antikoerper, APOBEC1CF antikoerper, ASP antikoerper, 1810073H04Rik antikoerper, Acf antikoerper, A1cft antikoerper, Apobec-1 antikoerper, acf antikoerper, acf64 antikoerper, acf65 antikoerper, apobec1cf antikoerper, asp antikoerper, A1CF antikoerper, APOBEC1 complementation factor antikoerper, apobec1 complementation factor antikoerper, APOBEC1 complementation factor L homeolog antikoerper, A1CF antikoerper, A1cf antikoerper, a1cf antikoerper, a1cf.L antikoerper
- Hintergrund
- Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene.
- Molekulargewicht
- 64 kDa (MW of target protein)
-
