HNRNPA1L2 Antikörper (N-Term)

Produktnummer ABIN633345

Produktdetails anti-HNRNPA1L2 Antikörper

Target: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA1L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RP11-78 J21.1 antibody was raised against the N terminal of RP11-78 21.1

Aufreinigung: Affinity purified

Immunogen: RP11-78 J21.1 antibody was raised using the N terminal of RP11-78 21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP11-78J21.1 Blocking Peptide, catalog no. 33R-6454, is also available for use as a blocking control in assays to test for specificity of this RP11-78J21.1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-70 21.1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPA1L2

Target: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Abstract: HNRNPA1L2 Produkte

Synonyme: heterogeneous nuclear ribonucleoprotein A1-like 2 antikoerper, heterogeneous nuclear ribonucleoprotein A1 antikoerper, HNRNPA1L2 antikoerper, LOC785761 antikoerper

Hintergrund: The function of RP11-78J21.1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)