GRSF1 Antikörper (Middle Region)
-
- Target Alle GRSF1 Antikörper anzeigen
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRSF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GRSF1 antibody was raised against the middle region of GRSF1
- Aufreinigung
- Affinity purified
- Immunogen
- GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
- Top Product
- Discover our top product GRSF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GRSF1 Blocking Peptide, catalog no. 33R-4139, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
- Andere Bezeichnung
- GRSF1 (GRSF1 Produkte)
- Synonyme
- GRSF1 antikoerper, wu:fb62c04 antikoerper, zgc:153305 antikoerper, MGC186196 antikoerper, B130010H02 antikoerper, BB232551 antikoerper, C80280 antikoerper, D5Wsu31e antikoerper, G-rich RNA sequence binding factor 1 antikoerper, G-rich RNA sequence binding factor 1 S homeolog antikoerper, GRSF1 antikoerper, grsf1 antikoerper, grsf1.S antikoerper, Grsf1 antikoerper
- Hintergrund
- GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.
- Molekulargewicht
- 53 kDa (MW of target protein)
-