CELF4 Antikörper

Produktnummer ABIN633349

Produktdetails anti-CELF4 Antikörper

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRUNOL4 Blocking Peptide, catalog no. 33R-7218, is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF4

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Andere Bezeichnung: BRUNOL4 (CELF4 Produkte)

Synonyme: brunol4 antikoerper, zgc:92761 antikoerper, brunol-4 antikoerper, BRUNOL-4 antikoerper, BRUNOL4 antikoerper, A230070D14Rik antikoerper, Brul4 antikoerper, Brunol4 antikoerper, C130060B05Rik antikoerper, CUGBP, Elav-like family member 4 antikoerper, CUGBP, Elav-like family member 4 L homeolog antikoerper, CUGBP Elav-like family member 4 antikoerper, celf4 antikoerper, celf4.L antikoerper, CELF4 antikoerper, Celf4 antikoerper, LOC100732038 antikoerper

Hintergrund: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane