RBM22 Antikörper (C-Term)

Produktnummer ABIN633355

Produktdetails anti-RBM22 Antikörper

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RBM22 antibody was raised against the C terminal of RBM22

Aufreinigung: Affinity purified

Immunogen: RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM22 Blocking Peptide, catalog no. 33R-4730, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM22

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Andere Bezeichnung: RBM22 (RBM22 Produkte)

Synonyme: Cwc2 antikoerper, ZC3H16 antikoerper, fSAP47 antikoerper, 8430430L24Rik antikoerper, fb37a01 antikoerper, zgc:77910 antikoerper, wu:fb37a01 antikoerper, wu:fc62e03 antikoerper, wu:fe05c04 antikoerper, RBM22 antikoerper, cg14641 antikoerper, RNA binding motif protein 22 antikoerper, RNA binding motif protein 22 S homeolog antikoerper, RBM22 antikoerper, Rbm22 antikoerper, rbm22 antikoerper, rbm22.S antikoerper

Hintergrund: RBM22 may be involved in pre-mRNA splicing.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus