DHX9 Antikörper

Produktnummer ABIN633361

Produktdetails anti-DHX9 Antikörper

Target: DHX9 (ATP-Dependent RNA Helicase A (DHX9))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX9 Blocking Peptide, catalog no. 33R-3397, is also available for use as a blocking control in assays to test for specificity of this DHX9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX9

Target: DHX9 (ATP-Dependent RNA Helicase A (DHX9))

Andere Bezeichnung: DHX9 (DHX9 Produkte)

Synonyme: DDX9 antikoerper, LKP antikoerper, NDH2 antikoerper, NDHII antikoerper, RHA antikoerper, AI326842 antikoerper, Ddx9 antikoerper, HEL-5 antikoerper, mHEL-5 antikoerper, DExH-box helicase 9 antikoerper, DEAH-box helicase 9 L homeolog antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 9 antikoerper, DHX9 antikoerper, dhx9.L antikoerper, Dhx9 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.

Molekulargewicht: 141 kDa (MW of target protein)