DHX9 Antikörper
-
- Target Alle DHX9 Antikörper anzeigen
- DHX9 (ATP-Dependent RNA Helicase A (DHX9))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
- Top Product
- Discover our top product DHX9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX9 Blocking Peptide, catalog no. 33R-3397, is also available for use as a blocking control in assays to test for specificity of this DHX9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX9 (ATP-Dependent RNA Helicase A (DHX9))
- Andere Bezeichnung
- DHX9 (DHX9 Produkte)
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.
- Molekulargewicht
- 141 kDa (MW of target protein)
-