DDX42 Antikörper
-
- Target Alle DDX42 Antikörper anzeigen
- DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX42 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
- Top Product
- Discover our top product DDX42 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX42 Blocking Peptide, catalog no. 33R-7187, is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX42 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))
- Andere Bezeichnung
- DDX42 (DDX42 Produkte)
- Hintergrund
- DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.
- Molekulargewicht
- 103 kDa (MW of target protein)
-