DDX25 Antikörper

Produktnummer ABIN633365

Produktdetails anti-DDX25 Antikörper

Target: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX25 Blocking Peptide, catalog no. 33R-9349, is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX25

Target: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Andere Bezeichnung: DDX25 (DDX25 Produkte)

Synonyme: DDX25 antikoerper, grth antikoerper, xcat3 antikoerper, zd10a antikoerper, deadsouth antikoerper, GRTH antikoerper, AW047046 antikoerper, DEAD-box helicase 25 antikoerper, DEAD-box helicase 25 L homeolog antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 25 antikoerper, DDX25 antikoerper, ddx25 antikoerper, ddx25.L antikoerper, Ddx25 antikoerper

Hintergrund: DDX25 is a member of DEAD box proteins family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molekulargewicht: 41 kDa (MW of target protein)