DDX27 Antikörper
-
- Target Alle DDX27 Antikörper anzeigen
- DDX27 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 27 (DDX27))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX27 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGLIGTIGEDDEVPVEPESDSGDEEEEGPIVLGRRQKALGKNRSADFNP
- Top Product
- Discover our top product DDX27 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX27 Blocking Peptide, catalog no. 33R-2044, is also available for use as a blocking control in assays to test for specificity of this DDX27 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX27 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX27 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 27 (DDX27))
- Andere Bezeichnung
- DDX27 (DDX27 Produkte)
- Synonyme
- cb843 antikoerper, DDX27 antikoerper, MGC114699 antikoerper, rhlp antikoerper, rrp3p antikoerper, pp3241 antikoerper, hspc259 antikoerper, DRS1 antikoerper, Drs1p antikoerper, PP3241 antikoerper, RHLP antikoerper, dJ686N3.1 antikoerper, C86129 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 antikoerper, DEAD-box helicase 27 antikoerper, DEAD-box helicase 27 L homeolog antikoerper, ddx27 antikoerper, DDX27 antikoerper, ddx27.L antikoerper, Ddx27 antikoerper
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX27 is a DEAD box protein, the function of which has not been determined.
- Molekulargewicht
- 90 kDa (MW of target protein)
-