DHX35 Antikörper
-
- Target Alle DHX35 Antikörper anzeigen
- DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX35 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ
- Top Product
- Discover our top product DHX35 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX35 Blocking Peptide, catalog no. 33R-5605, is also available for use as a blocking control in assays to test for specificity of this DHX35 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX35 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))
- Andere Bezeichnung
- DHX35 (DHX35 Produkte)
- Synonyme
- MGC146350 antikoerper, C20orf15 antikoerper, DDX35 antikoerper, KAIA0875 antikoerper, 1200009D07Rik antikoerper, Ddx35 antikoerper, probable ATP-dependent RNA helicase DHX35 antikoerper, DEAH-box helicase 35 antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 35 antikoerper, LOC413147 antikoerper, DHX35 antikoerper, dhx35 antikoerper, LOC100633419 antikoerper, Dhx35 antikoerper
- Hintergrund
- DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.
- Molekulargewicht
- 79 kDa (MW of target protein)
-