RED1 Antikörper
-
- Target Alle RED1 (ADARB1) Antikörper anzeigen
- RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RED1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEE
- Top Product
- Discover our top product ADARB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADARB1 Blocking Peptide, catalog no. 33R-6800, is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))
- Andere Bezeichnung
- ADARB1 (ADARB1 Produkte)
- Synonyme
- ADARB1 antikoerper, RED1 antikoerper, ADAR2 antikoerper, DRABA2 antikoerper, DRADA2 antikoerper, 1700057H01Rik antikoerper, AW124433 antikoerper, AW558573 antikoerper, Adar2 antikoerper, BB220382 antikoerper, D10Bwg0447e antikoerper, Red1 antikoerper, adar2 antikoerper, adarb1 antikoerper, red1 antikoerper, adenosine deaminase, RNA specific B1 antikoerper, adenosine deaminase, RNA-specific, B1 antikoerper, adenosine deaminase, RNA-specific, B1 L homeolog antikoerper, adenosine deaminase, RNA-specific, B1a antikoerper, ADARB1 antikoerper, adarb1 antikoerper, adarb1.L antikoerper, Adarb1 antikoerper, adarb1a antikoerper
- Hintergrund
- ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.
- Molekulargewicht
- 80 kDa (MW of target protein)
-