RG9MTD1 Antikörper

Produktnummer ABIN633378

Produktdetails anti-RG9MTD1 Antikörper

Target: RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RG9MTD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RG9MTD1 Blocking Peptide, catalog no. 33R-6162, is also available for use as a blocking control in assays to test for specificity of this RG9MTD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RG9MTD1

Target: RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))

Andere Bezeichnung: RG9MTD1 (RG9MTD1 Produkte)

Synonyme: RG9MTD1 antikoerper, rg9mtd1 antikoerper, wu:fb53e06 antikoerper, zgc:103570 antikoerper, HNYA antikoerper, MRPP1 antikoerper, Rg9mtd1 antikoerper, 1300018J16Rik antikoerper, D16Ertd454e antikoerper, Rnmtd1 antikoerper, tRNA methyltransferase 10C, mitochondrial RNase P subunit antikoerper, tRNA methyltransferase 10C, mitochondrial RNase P subunit L homeolog antikoerper, tRNA methyltransferase 10C antikoerper, TRMT10C antikoerper, trmt10c antikoerper, trmt10c.L antikoerper, Trmt10c antikoerper

Hintergrund: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.

Molekulargewicht: 47 kDa (MW of target protein)