KHSRP Antikörper (Middle Region)
-
- Target Alle KHSRP Antikörper anzeigen
- KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KHSRP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KHSRP antibody was raised against the middle region of KHSRP
- Aufreinigung
- Affinity purified
- Immunogen
- KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
- Top Product
- Discover our top product KHSRP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))
- Andere Bezeichnung
- KHSRP (KHSRP Produkte)
- Synonyme
- FBP2 antikoerper, FUBP2 antikoerper, KSRP antikoerper, 6330409F21Rik antikoerper, Fbp2 antikoerper, Fubp2 antikoerper, Ksrp antikoerper, Marta1 antikoerper, KHSRP antikoerper, VgRBP71 antikoerper, fbp2 antikoerper, ksrp antikoerper, fubp2 antikoerper, fc94c12 antikoerper, wu:fb25b12 antikoerper, wu:fc10e10 antikoerper, wu:fc94c12 antikoerper, zgc:163038 antikoerper, khsrp-b antikoerper, KH-type splicing regulatory protein antikoerper, KH-type splicing regulatory protein L homeolog antikoerper, KH-type splicing regulatory protein S homeolog antikoerper, KHSRP antikoerper, Khsrp antikoerper, khsrp.L antikoerper, khsrp antikoerper, khsrp.S antikoerper
- Hintergrund
- KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).
- Molekulargewicht
- 73 kDa (MW of target protein)
-