ANKRD42 Antikörper (N-Term)

Produktnummer ABIN633385

Produktdetails anti-ANKRD42 Antikörper

Target: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANKRD42 antibody was raised against the N terminal of ANKRD42

Aufreinigung: Affinity purified

Immunogen: ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD42 Blocking Peptide, catalog no. 33R-7191, is also available for use as a blocking control in assays to test for specificity of this ANKRD42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD42

Target: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Andere Bezeichnung: ANKRD42 (ANKRD42 Produkte)

Synonyme: SARP antikoerper, 4931426M20 antikoerper, 4933417L02Rik antikoerper, Ikbn antikoerper, RGD1310789 antikoerper, ANKRD42 antikoerper, DKFZp469H1622 antikoerper, ankyrin repeat domain 42 antikoerper, ankyrin repeat domain 42 L homeolog antikoerper, ANKRD42 antikoerper, Ankrd42 antikoerper, ankrd42.L antikoerper

Hintergrund: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)