MGC70863 Antikörper (N-Term)

Produktnummer ABIN633386

Produktdetails anti-MGC70863 Antikörper

Target: MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: MGC70863 antibody was raised against the N terminal of MGC70863

Aufreinigung: Affinity purified

Immunogen: MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC70863 Blocking Peptide, catalog no. 33R-6469, is also available for use as a blocking control in assays to test for specificity of this MGC70863 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70863 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MGC70863

Target: MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))

Andere Bezeichnung: MGC70863 (RPL23AP82 Produkte)

Synonyme: MGC70863 antikoerper, RPL23A_43_1761 antikoerper, ribosomal protein L23a pseudogene 82 antikoerper, RPL23AP82 antikoerper

Hintergrund: The function of MGC70863 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 14 kDa (MW of target protein)