C6orf201 Antikörper (N-Term)

Produktnummer ABIN633387

Produktdetails anti-C6orf201 Antikörper

Target: C6orf201 (Chromosome 6 Open Reading Frame 201 (C6orf201))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C6orf201 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C6 ORF201 antibody was raised against the N terminal Of C6 rf201

Aufreinigung: Affinity purified

Immunogen: C6 ORF201 antibody was raised using the N terminal Of C6 rf201 corresponding to a region with amino acids PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF201 Blocking Peptide, catalog no. 33R-7072, is also available for use as a blocking control in assays to test for specificity of this C6ORF201 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF201 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C6orf201

Target: C6orf201 (Chromosome 6 Open Reading Frame 201 (C6orf201))

Andere Bezeichnung: C6ORF201 (C6orf201 Produkte)

Synonyme: dJ1013A10.5 antikoerper, chromosome 6 open reading frame 201 antikoerper, C6orf201 antikoerper

Hintergrund: The specific function of C6orf201 is not yet known.

Molekulargewicht: 14 kDa (MW of target protein)