SF3A1 Antikörper (N-Term)

Produktnummer ABIN633401

Produktdetails anti-SF3A1 Antikörper

Target: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SF3A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SF3 A1 antibody was raised against the N terminal of SF3 1

Aufreinigung: Affinity purified

Immunogen: SF3 A1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3A1 Blocking Peptide, catalog no. 33R-8124, is also available for use as a blocking control in assays to test for specificity of this SF3A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SF3A1

Target: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Andere Bezeichnung: SF3A1 (SF3A1 Produkte)

Hintergrund: SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP motifs that are thought to mediate RNA binding.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization