EIF2D Antikörper (Middle Region)
-
- Target Alle EIF2D Antikörper anzeigen
- EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF2D Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ligatin antibody was raised against the middle region of LGTN
- Aufreinigung
- Affinity purified
- Immunogen
- Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ
- Top Product
- Discover our top product EIF2D Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ligatin Blocking Peptide, catalog no. 33R-4725, is also available for use as a blocking control in assays to test for specificity of this Ligatin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGTN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))
- Andere Bezeichnung
- Ligatin (EIF2D Produkte)
- Synonyme
- LGTN antikoerper, HCA56 antikoerper, D1Ertd5e antikoerper, Lgtn antikoerper, eukaryotic translation initiation factor 2D antikoerper, EIF2D antikoerper, Eif2d antikoerper
- Hintergrund
- LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.
- Molekulargewicht
- 65 kDa (MW of target protein)
-