RBPMS2 Antikörper (Middle Region)

Produktnummer ABIN633407

Produktdetails anti-RBPMS2 Antikörper

Target: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBPMS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBPMS2 antibody was raised against the middle region of RBPMS2

Aufreinigung: Affinity purified

Immunogen: RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBPMS2 Blocking Peptide, catalog no. 33R-6010, is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBPMS2

Target: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Andere Bezeichnung: RBPMS2 (RBPMS2 Produkte)

Synonyme: hermes antikoerper, RBPMS antikoerper, 2400008B06Rik antikoerper, AI316523 antikoerper, RGD1561222 antikoerper, rbpms2 antikoerper, zgc:55559 antikoerper, zgc:77170 antikoerper, RNA binding protein with multiple splicing 2 L homeolog antikoerper, RNA binding protein with multiple splicing 2 antikoerper, RNA binding protein with multiple splicing 2b antikoerper, rbpms2.L antikoerper, RBPMS2 antikoerper, Rbpms2 antikoerper, rbpms2b antikoerper

Hintergrund: The function of RBPMS2 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 22 kDa (MW of target protein)