PABPC5 Antikörper

Produktnummer ABIN633413

Produktdetails anti-PABPC5 Antikörper

Target: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PABPC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PABPC5 Blocking Peptide, catalog no. 33R-1849, is also available for use as a blocking control in assays to test for specificity of this PABPC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PABPC5

Target: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Andere Bezeichnung: PABPC5 (PABPC5 Produkte)

Synonyme: PABPC5 antikoerper, PABP5 antikoerper, C820015E17 antikoerper, poly(A) binding protein cytoplasmic 5 antikoerper, poly A binding protein, cytoplasmic 5 antikoerper, poly(A) binding protein, cytoplasmic 5 antikoerper, PABPC5 antikoerper, Pabpc5 antikoerper

Hintergrund: PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.

Molekulargewicht: 43 kDa (MW of target protein)