SR140 Antikörper (N-Term)

Produktnummer ABIN633416

Produktdetails anti-SR140 Antikörper

Target: SR140 (U2-Associated SR140 Protein (SR140))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SR140 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SR140 antibody was raised against the N terminal of SR140

Aufreinigung: Affinity purified

Immunogen: SR140 antibody was raised using the N terminal of SR140 corresponding to a region with amino acids NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SR140 Blocking Peptide, catalog no. 33R-6779, is also available for use as a blocking control in assays to test for specificity of this SR140 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SR140 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SR140

Target: SR140 (U2-Associated SR140 Protein (SR140))

Andere Bezeichnung: SR140 (SR140 Produkte)

Synonyme: SR140 antikoerper, fSAPa antikoerper, 2610101N10Rik antikoerper, AU023006 antikoerper, Sr140 antikoerper, U2-associated SR140 protein antikoerper, U2 snRNP associated SURP domain containing antikoerper, U2 snRNP-associated SURP domain containing antikoerper, CpipJ_CPIJ014539 antikoerper, U2SURP antikoerper, U2surp antikoerper

Hintergrund: The specific function of SR140 is not yet known.

Molekulargewicht: 118 kDa (MW of target protein)