SRP54 Antikörper (Middle Region)

Produktnummer ABIN633422

Produktdetails anti-SRP54 Antikörper

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRP54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SRP54 antibody was raised against the middle region of SRP54

Aufreinigung: Affinity purified

Immunogen: SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRP54 Blocking Peptide, catalog no. 33R-2603, is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRP54

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Andere Bezeichnung: SRP54 (SRP54 Produkte)

Synonyme: Srp54k antikoerper, zgc:55842 antikoerper, zgc:85713 antikoerper, SRP54 antikoerper, signal recognition particle 54 antikoerper, signal recognition particle protein antikoerper, signal recognition particle subunit Srp54 antikoerper, signal recognition particle antikoerper, family with sequence similarity 177 member A1 antikoerper, signal recognition particle 54kDa S homeolog antikoerper, signal recognition particle 54kDa antikoerper, SRP54 antikoerper, srp54 antikoerper, SSO_RS04840 antikoerper, MA_RS23935 antikoerper, AF_RS03170 antikoerper, PAB_RS02540 antikoerper, MSP_RS07670 antikoerper, RCI_RS04175 antikoerper, TGAM_RS09885 antikoerper, MTBMA_RS08340 antikoerper, FAM177A1 antikoerper, srp54.S antikoerper, Srp54 antikoerper

Hintergrund: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom