SRP54 Antikörper (Middle Region)

Produktnummer ABIN633422

Produktdetails anti-SRP54 Antikörper

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRP54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SRP54 antibody was raised against the middle region of SRP54

Aufreinigung: Affinity purified

Immunogen: SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRP54 Blocking Peptide, catalog no. 33R-2603, is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRP54

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Andere Bezeichnung: SRP54 (SRP54 Produkte)

Hintergrund: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom