CTIF/KIAA0427 Antikörper (N-Term)
-
- Target Alle CTIF/KIAA0427 (CTIF) Antikörper anzeigen
- CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CTIF/KIAA0427 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIAA0427 antibody was raised against the N terminal of KIAA0427
- Aufreinigung
- Affinity purified
- Immunogen
- KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN
- Top Product
- Discover our top product CTIF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIAA0427 Blocking Peptide, catalog no. 33R-7783, is also available for use as a blocking control in assays to test for specificity of this KIAA0427 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0427 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))
- Andere Bezeichnung
- KIAA0427 (CTIF Produkte)
- Synonyme
- Gm672 antikoerper, KIAA0427 antikoerper, gm672 antikoerper, kiaa0427 antikoerper, cap binding complex dependent translation initiation factor antikoerper, CBP80/20-dependent translation initiation factor antikoerper, similar to Peroxisomal biogenesis factor 19 (Peroxin-19) (Peroxisomal farnesylated protein) antikoerper, CTIF antikoerper, ctif antikoerper, Ctif antikoerper, LOC679129 antikoerper
- Hintergrund
- CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay. On mRNAs without PTCs, the CBP80/CBP20 complex is replaced with cytoplasmic mRNA cap-binding proteins, including EIF4G, and steady-state translation of the mRNAs resumes in the cytoplasm.
- Molekulargewicht
- 67 kDa (MW of target protein)
-