CPSF2 Antikörper (N-Term)
-
- Target Alle CPSF2 Antikörper anzeigen
- CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPSF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CPSF2 antibody was raised against the N terminal of CPSF2
- Aufreinigung
- Affinity purified
- Immunogen
- CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA
- Top Product
- Discover our top product CPSF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CPSF2 Blocking Peptide, catalog no. 33R-10053, is also available for use as a blocking control in assays to test for specificity of this CPSF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))
- Andere Bezeichnung
- CPSF2 (CPSF2 Produkte)
- Hintergrund
- CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.
- Molekulargewicht
- 88 kDa (MW of target protein)
-