Filensin Antikörper (N-Term)
-
- Target Alle Filensin (BFSP1) Antikörper anzeigen
- Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Filensin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BFSP1 antibody was raised against the N terminal of BFSP1
- Aufreinigung
- Affinity purified
- Immunogen
- BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM
- Top Product
- Discover our top product BFSP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BFSP1 Blocking Peptide, catalog no. 33R-7771, is also available for use as a blocking control in assays to test for specificity of this BFSP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BFSP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
BNIP3L/NIX is required for elimination of mitochondria, endoplasmic reticulum and Golgi apparatus during eye lens organelle-free zone formation." in: Experimental eye research, Vol. 174, pp. 173-184, (2019) (PubMed).
: "
-
BNIP3L/NIX is required for elimination of mitochondria, endoplasmic reticulum and Golgi apparatus during eye lens organelle-free zone formation." in: Experimental eye research, Vol. 174, pp. 173-184, (2019) (PubMed).
-
- Target
- Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))
- Andere Bezeichnung
- BFSP1 (BFSP1 Produkte)
- Hintergrund
- More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament.
- Molekulargewicht
- 74 kDa (MW of target protein)
-