Filensin Antikörper (N-Term)

Produktnummer ABIN633449

Produktdetails anti-Filensin Antikörper

Target: Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Filensin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BFSP1 antibody was raised against the N terminal of BFSP1

Aufreinigung: Affinity purified

Immunogen: BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BFSP1 Blocking Peptide, catalog no. 33R-7771, is also available for use as a blocking control in assays to test for specificity of this BFSP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BFSP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-Filensin Antikörper (ABIN633449)

Brennan, McGreal-Estrada, Logan, Cvekl, Menko, Kantorow: "BNIP3L/NIX is required for elimination of mitochondria, endoplasmic reticulum and Golgi apparatus during eye lens organelle-free zone formation." in: Experimental eye research, Vol. 174, pp. 173-184, (2019) (PubMed).

Details zu Filensin

Target: Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))

Andere Bezeichnung: BFSP1 (BFSP1 Produkte)

Synonyme: BFSP1 antikoerper, CP115 antikoerper, CP94 antikoerper, CTRCT33 antikoerper, LIFL-H antikoerper, Bfsp1 antikoerper, 115-kDa antikoerper, CP95 antikoerper, CP97 antikoerper, MGC84254 antikoerper, LOC100220461 antikoerper, beaded filament structural protein 1 antikoerper, beaded filament structural protein 1 L homeolog antikoerper, beaded filament structural protein 1, in lens-CP94 antikoerper, BFSP1 antikoerper, Bfsp1 antikoerper, bfsp1.L antikoerper

Hintergrund: More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament.

Molekulargewicht: 74 kDa (MW of target protein)