TNRC6B Antikörper (N-Term)

Produktnummer ABIN633454

Produktdetails anti-TNRC6B Antikörper

Target: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNRC6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TNRC6 B antibody was raised against the N terminal of TNRC6

Aufreinigung: Affinity purified

Immunogen: TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNRC6B Blocking Peptide, catalog no. 33R-5339, is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNRC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNRC6B

Target: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Andere Bezeichnung: TNRC6B (TNRC6B Produkte)

Synonyme: hm:zeh0114 antikoerper, im:6968518 antikoerper, wu:fa01f05 antikoerper, 2700090M07Rik antikoerper, A730065C02Rik antikoerper, AI848765 antikoerper, D230019K20Rik antikoerper, Cbl27 antikoerper, trinucleotide repeat containing 6b antikoerper, trinucleotide repeat containing 6B antikoerper, trinucleotide repeat containing 6B S homeolog antikoerper, tnrc6b antikoerper, TNRC6B antikoerper, tnrc6b.S antikoerper, Tnrc6b antikoerper

Hintergrund: TNRC6B is involved in the binding of RNA and nucleotides.

Molekulargewicht: 109 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway