TNRC6B Antikörper (N-Term)
-
- Target Alle TNRC6B Antikörper anzeigen
- TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNRC6B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TNRC6 B antibody was raised against the N terminal of TNRC6
- Aufreinigung
- Affinity purified
- Immunogen
- TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG
- Top Product
- Discover our top product TNRC6B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TNRC6B Blocking Peptide, catalog no. 33R-5339, is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNRC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))
- Andere Bezeichnung
- TNRC6B (TNRC6B Produkte)
- Hintergrund
- TNRC6B is involved in the binding of RNA and nucleotides.
- Molekulargewicht
- 109 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway
-