SFRS9 Antikörper (Middle Region)
-
- Target Alle SFRS9 Antikörper anzeigen
- SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFRS9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFRS9 antibody was raised against the middle region of SFRS9
- Aufreinigung
- Affinity purified
- Immunogen
- SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER
- Top Product
- Discover our top product SFRS9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))
- Andere Bezeichnung
- SFRS9 (SFRS9 Produkte)
- Hintergrund
- SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-