DAZ2 Antikörper (N-Term)

Produktnummer ABIN633469

Produktdetails anti-DAZ2 Antikörper

Target: DAZ2 (Deleted in Azoospermia 2 (DAZ2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZ2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: DAZ2 antibody was raised against the N terminal of DAZ2

Aufreinigung: Affinity purified

Immunogen: DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZ2 Blocking Peptide, catalog no. 33R-5830, is also available for use as a blocking control in assays to test for specificity of this DAZ2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZ2

Target: DAZ2 (Deleted in Azoospermia 2 (DAZ2))

Andere Bezeichnung: DAZ2 (DAZ2 Produkte)

Synonyme: pDP1678 antikoerper, DAZ2 antikoerper, deleted in azoospermia 2 antikoerper, deleted in azoospermia protein 2 antikoerper, DAZ2 antikoerper, LOC738583 antikoerper

Hintergrund: DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Molekulargewicht: 59 kDa (MW of target protein)