RBPMS Antikörper (N-Term)
-
- Target Alle RBPMS Antikörper anzeigen
- RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBPMS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBPMS antibody was raised against the N terminal of RBPMS
- Aufreinigung
- Affinity purified
- Immunogen
- RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD
- Top Product
- Discover our top product RBPMS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBPMS Blocking Peptide, catalog no. 33R-7880, is also available for use as a blocking control in assays to test for specificity of this RBPMS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))
- Andere Bezeichnung
- RBPMS (RBPMS Produkte)
- Hintergrund
- RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.
- Molekulargewicht
- 22 kDa (MW of target protein)
-