IGF2BP1 Antikörper (N-Term)

Produktnummer ABIN633481

Produktdetails anti-IGF2BP1 Antikörper

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGF2BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IGF2 BP1 antibody was raised against the N terminal of IGF2 P1

Aufreinigung: Affinity purified

Immunogen: IGF2 BP1 antibody was raised using the N terminal of IGF2 P1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGF2BP1 Blocking Peptide, catalog no. 33R-7007, is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGF2BP1

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Andere Bezeichnung: IGF2BP1 (IGF2BP1 Produkte)

Synonyme: IGF2BP1 antikoerper, ZBP1 antikoerper, CRD-BP antikoerper, CRDBP antikoerper, IMP-1 antikoerper, IMP1 antikoerper, VICKZ1 antikoerper, AL024068 antikoerper, AW549074 antikoerper, Crdbp antikoerper, D030026A21Rik antikoerper, D11Moh40e antikoerper, D11Moh45 antikoerper, Neilsen antikoerper, Zbp1 antikoerper, Imp1 antikoerper, wu:fi72a06 antikoerper, zgc:152963 antikoerper, insulin like growth factor 2 mRNA binding protein 1 antikoerper, insulin-like growth factor 2 mRNA binding protein 1 antikoerper, IGF2BP1 antikoerper, Igf2bp1 antikoerper, igf2bp1 antikoerper

Hintergrund: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.

Molekulargewicht: 63 kDa (MW of target protein)